PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN541320.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 571aa    MW: 64586.2 Da    PI: 6.1758
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN541320.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.65.4e-1282025702373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL++cAea+s++ +e+ ++l+++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +   s+e l++++++++++P++kf
  KN541320.1_FGP002 202 KQLLTRCAEALSEDRTEEFHKLVQEARGVVSINGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCREPE---SKELLSYMRILYNICPYFKF 290
                        689*****************************************************************9...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        ++++aN aI ea+ +e+ +HiiDf+i qG+QW++L+qaLa+Rp+gpp++RiTg+++p s+  + e l  +g+ L+++ ee+++p+ef++l +
  KN541320.1_FGP002 291 GYMAANGAIAEALRTENNIHIIDFQIAQGTQWITLIQALAARPGGPPRVRITGIDDPVSEyaRGEGLDIVGKMLKSMSEEFKIPLEFTPL-S 381
                        *********************************************************999999**************************6.7 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                           ++++ e+L+++pgEalaVn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+ +n+++Fl rf e++eyysa+f+s++a+l
  KN541320.1_FGP002 382 VYATQVTKEMLEIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFGETMEYYSAMFESIDANL 473
                        8899999************************************************************************************* PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        pr+++eri+vE+++l+++ivn++aceg++r+erhe l+kW++rl++aGF+p+pls+++++ ++ ll+ ++ d y+++e++g+++lgW++r+L
  KN541320.1_FGP002 474 PRDNKERISVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFRPYPLSSYVNSVIRKLLACYS-DKYTLDEKDGAMLLGWRSRKL 564
                        ******************************************************************9999.55******************* PP

               GRAS 368 vsvSaW 373
                        +s+SaW
  KN541320.1_FGP002 565 ISASAW 570
                        ****** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.301175552IPR005202Transcription factor GRAS
PfamPF035141.9E-125202570IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MDLHQLLKYR LTGANVVYEI PTENNLQNSP WQANPLKYEF SDSPYTPLSS QFECDNLSAL  60
TNTPDNQSST ETISAQPISP LEADSSYRQA GILLQENIQV GADPLYATSR HNMQHALREI  120
ETVLMAPDTD DATTSTKHEF EEIKPAQLVR QRSRTWSHES RQPLPGVGRS QFASGGYPTA  180
SYEFRPEKRQ RELREDPQII VKQLLTRCAE ALSEDRTEEF HKLVQEARGV VSINGEPIQR  240
LGAYLLEGLV ARHGNSGTNI YRALKCREPE SKELLSYMRI LYNICPYFKF GYMAANGAIA  300
EALRTENNIH IIDFQIAQGT QWITLIQALA ARPGGPPRVR ITGIDDPVSE YARGEGLDIV  360
GKMLKSMSEE FKIPLEFTPL SVYATQVTKE MLEIRPGEAL AVNFTLQLHH TPDESVDVNN  420
PRDGLLRMVK GLSPKVTTLV EQESHTNTTP FLMRFGETME YYSAMFESID ANLPRDNKER  480
ISVEQHCLAK DIVNIIACEG KDRVERHELL GKWKSRLTMA GFRPYPLSSY VNSVIRKLLA  540
CYSDKYTLDE KDGAMLLGWR SRKLISASAW H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-612015714375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0042350.0AP004235.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0006G05.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646796.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A0E0Q9K20.0A0A0E0Q9K2_ORYRU; Uncharacterized protein
STRINGLOC_Os07g36170.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106313643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein